PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G025900.1.p
Common NameGLYMA_09G025900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 710aa    MW: 79697.5 Da    PI: 6.2128
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G025900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.73e-162172556
                         SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          ++++ q+ +Le++ + +++p++++r++LA+++gL+++q+k+WFqN+R++ k
  Glyma.09G025900.1.p 21 KRLSSAQTARLERFIKDCPHPDEAQRRQLASEIGLETKQIKFWFQNKRTQIK 72
                         67899*******************************************9988 PP

2START140.32e-442234452206
                          HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          +a +a++elv+++  +ep+W+kss      +++ + + ++f+++++      ++ea ++sg+v  ++ +l   +ld   +W + ++    
  Glyma.09G025900.1.p 223 VAAAAMNELVRLIRINEPLWTKSStqdgkPILQHENYEKIFPRTNSfkganLRVEATKESGIVSINSIQLIDMFLDPD-KWVNLFPtivt 311
                          6889**********************999999999******99999999*******************9999999988.99999999999 PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          kaet++vi++g      galqlm+ ++ +lsplv  R+f f+Ry++q ++g+wvi+dvS ds ++++   s+  + ++pSg++i++++ng
  Glyma.09G025900.1.p 312 KAETMKVIENGlvgsrsGALQLMFEQMHVLSPLVQpREFQFLRYCQQIEEGVWVIADVSFDSFRQKT---SFFHSWRHPSGCMIQEMPNG 398
                          ********************************9977*********************9999999987...79****************** PP

                          EEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                           s vtwvehv++++++  h+l++ l+ +g+a ga +w   lqr ce+
  Glyma.09G025900.1.p 399 CSMVTWVEHVEVDDKIQtHQLYKDLIATGIAYGAERWIMELQRICER 445
                          ***************999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-17472IPR009057Homeodomain-like
SuperFamilySSF466891.04E-151178IPR009057Homeodomain-like
PROSITE profilePS5007115.4991474IPR001356Homeobox domain
CDDcd000866.85E-151675No hitNo description
SMARTSM003899.6E-161678IPR001356Homeobox domain
PfamPF000467.9E-142072IPR001356Homeobox domain
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
PROSITE profilePS5084844.378213448IPR002913START domain
SuperFamilySSF559617.83E-32216446No hitNo description
CDDcd088751.10E-101217444No hitNo description
SMARTSM002341.7E-33222445IPR002913START domain
PfamPF018522.4E-36223445IPR002913START domain
Gene3DG3DSA:3.30.530.209.1E-10225410IPR023393START-like domain
SuperFamilySSF559612.33E-10501672No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MASPGGSGDE GSHQGRRPSY KRLSSAQTAR LERFIKDCPH PDEAQRRQLA SEIGLETKQI  60
KFWFQNKRTQ IKNQHERADN TALRVENDRI HTENLLMKEA LKNMLCSSCG GAPCQEEDHE  120
HAIQNMQLEN AQLKEEHEKV SSLLARYLEK QMSPPELQQQ AFNIPIIGSS SHAPELENSS  180
INYEIGGSSS SHGPSRYGMQ IMVSDDHNLL RSEGIEKALM FKVAAAAMNE LVRLIRINEP  240
LWTKSSTQDG KPILQHENYE KIFPRTNSFK GANLRVEATK ESGIVSINSI QLIDMFLDPD  300
KWVNLFPTIV TKAETMKVIE NGLVGSRSGA LQLMFEQMHV LSPLVQPREF QFLRYCQQIE  360
EGVWVIADVS FDSFRQKTSF FHSWRHPSGC MIQEMPNGCS MVTWVEHVEV DDKIQTHQLY  420
KDLIATGIAY GAERWIMELQ RICERFACFY VERIPSQDSG GVINSLEGRR SVMNFSHRMI  480
KVFCESLTMS GNLDFPHMNM ENNSGLRVSI RKNRNHLGQP KGMIVVAATS IWLPLHYMKV  540
FEFFTDDRRR AQWDVLCFGN DANKVAHISN EIHPGNCISI YRPFIPNENN ALVLQESFTT  600
PMGSYVVYAP TDVAAMNSAI NGEDSSMLPV LPSGFVISAD GEPNAALGAF NSSDIERLGG  660
SLLTVAFQIL ASSPDGINMS NMESVEAVNS LLTSTILKVK DALNCNNLE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586853.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
TrEMBLK7LBG80.0K7LBG8_SOYBN; Uncharacterized protein
STRINGGLYMA09G03000.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11